PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo2G0024600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 253aa    MW: 28693.3 Da    PI: 4.9024
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo2G0024600genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.54.1e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W+  Ed++lvd+++  G g W+  +r+ g++R++k+c++rw++yl
   Spipo2G0024600 14 RGAWSSAEDKILVDYINAQGEGKWRDLPRRAGLKRCGKSCRLRWLNYL 61
                     89********************************************97 PP

2Myb_DNA-binding52.89.4e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ ++eE++l+++++k+lG++ W++Ia +++ gRt++++k++w++ 
   Spipo2G0024600  67 RGNISKEEEDLIIRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNTN 111
                      7899******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.82961IPR017930Myb domain
SuperFamilySSF466896.88E-2812108IPR009057Homeodomain-like
SMARTSM007171.2E-101363IPR001005SANT/Myb domain
PfamPF002491.1E-121461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-211568IPR009057Homeodomain-like
CDDcd001677.64E-71661No hitNo description
PROSITE profilePS5129424.74362116IPR017930Myb domain
SMARTSM007171.6E-1666114IPR001005SANT/Myb domain
PfamPF002493.8E-1567112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-2469115IPR009057Homeodomain-like
CDDcd001671.20E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MGRRPCCAKE GLNRGAWSSA EDKILVDYIN AQGEGKWRDL PRRAGLKRCG KSCRLRWLNY  60
LRPDIKRGNI SKEEEDLIIR LHKLLGNRWS LIAGRLPGRT DNEIKNYWNT NLSKKGVIRT  120
KAARCTRIFF PAPPAQEAAA HQTEESDCRD TAFPQRDDCL GILHDFDIDE LMSNTEELDF  180
LCVSRGDCEE YSPVYCGDGN ECAPSTPDRL FFFEEAILED WRECLQPIAT TDLPAAMASC  240
LDSDEWPEKT EG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-261211525127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008784294.11e-83PREDICTED: transcription repressor MYB6-like
SwissprotP102902e-62MYBC_MAIZE; Anthocyanin regulatory C1 protein
TrEMBLA0A0J8B8962e-82A0A0J8B896_BETVU; Uncharacterized protein
STRINGGSMUA_Achr3P07940_0014e-81(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.12e-60myb domain protein 3